Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB41 Rabbit Polyclonal Antibody (Biotin)

EPB41 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HE, EL1, 4.1R

UniProt

P11171

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EPB41

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_004428

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CN166 Rabbit Polyclonal Antibody
MBS9512929-01 0.05 mL

CN166 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CN166 Rabbit Polyclonal Antibody
MBS9512929-02 0.1 mL

CN166 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CN166 Rabbit Polyclonal Antibody
MBS9512929-03 5x 0.1 mL

CN166 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR11A1, CT (OR11A1, OR11A2, Olfactory receptor 11A1, Hs6M1-18, Olfactory receptor 11A2, Olfactory receptor OR6-30) (FITC) discontinued
039316-FITC 200 µL

OR11A1, CT (OR11A1, OR11A2, Olfactory receptor 11A1, Hs6M1-18, Olfactory receptor 11A2, Olfactory receptor OR6-30) (FITC) discontinued

Sign In for Pricing
View Details
Rabbit Anti-Human Annexin I (phospho Tyr21) Polyclonal Antibody
PA85556HU-01 50 µg

Rabbit Anti-Human Annexin I (phospho Tyr21) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Annexin I (phospho Tyr21) Polyclonal Antibody
PA85556HU-02 100 µg

Rabbit Anti-Human Annexin I (phospho Tyr21) Polyclonal Antibody

Sign In for Pricing
View Details