Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB41 Rabbit Polyclonal Antibody (FITC)

EPB41 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HE, EL1, 4.1R

UniProt

P11171

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EPB41

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_004428

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CHGA/777), CF568 conjugate, 0.1mg/mL
BNC680777-100 1x 100 µL

Chromogranin A (CHGA/777), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C10orf137 (EDRF1) Human Gene Knockout Kit (CRISPR)
KN418028 1 Kit

C10orf137 (EDRF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1X4 Color™ V405 Dye Set
8000-AAT 1 Set

1X4 Color™ V405 Dye Set

Sign In for Pricing
View Details
CRHR2 Antibody
8G073-AAT 50 µg

CRHR2 Antibody

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF405S conjugate, 0.1mg/mL
BNC043113-100 1x 100 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Fam219a activation kit by CRISPRa
GA209007 1 Kit

Mouse Fam219a activation kit by CRISPRa

Sign In for Pricing
View Details