Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBPC2 Rabbit Polyclonal Antibody (HRP)

MYBPC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MYBPC, MYBPCF, fsMyBP-C

UniProt

A1L4G9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

128kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004524

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit
MBS9369067-01 48 Well

Monkey SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit

Sign In for Pricing
View Details
Monkey SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit
MBS9369067-02 96 Well

Monkey SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit

Sign In for Pricing
View Details
Monkey SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit
MBS9369067-03 5x 96 Well

Monkey SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit

Sign In for Pricing
View Details
Monkey SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit
MBS9369067-04 10x 96 Well

Monkey SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit

Sign In for Pricing
View Details
Ibsp Mouse Pre-designed siRNA Set A
HY-RS17811 1 Set

Ibsp Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
MOCS2, NT (MOCS2, MCBPE, MOCO1, Molybdopterin synthase catalytic subunit, MOCO1-B, Molybdenum cofactor synthesis protein 2 large subunit, Molybdenum cofactor synthesis protein 2B, Molybdopterin-synthase large subunit) (MaxLight 405) discontinued
038530-ML405 100 µL

MOCS2, NT (MOCS2, MCBPE, MOCO1, Molybdopterin synthase catalytic subunit, MOCO1-B, Molybdenum cofactor synthesis protein 2 large subunit, Molybdenum cofactor synthesis protein 2B, Molybdopterin-synthase large subunit) (MaxLight 405) discontinued

Sign In for Pricing
View Details