Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRR3 Rabbit Polyclonal Antibody (Biotin)

SPRR3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9UBC9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPRR3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005407

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AML12 Cell Line
CL-0602 1x 10^6 Cells/Vial - 2 Vials

AML12 Cell Line

Sign In for Pricing
View Details
hsa-miR-382-5p miRNA Antagomir
MNH02108 2x 5.0 nmol

hsa-miR-382-5p miRNA Antagomir

Sign In for Pricing
View Details
Osteocalcin Monoclonal Antibody, RBITC Conjugated
bsm-25439M-RBITC 100 µL

Osteocalcin Monoclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
IFIT1 (Interferon-induced Protein with Tetratricopeptide Repeats 1, IFIT-1, Interferon-induced 56kD Protein, IFI-56K, P56, G10P1, IFI56, IFNAI1, ISG56) (HRP)
128245-HRP 100 µL

IFIT1 (Interferon-induced Protein with Tetratricopeptide Repeats 1, IFIT-1, Interferon-induced 56kD Protein, IFI-56K, P56, G10P1, IFI56, IFNAI1, ISG56) (HRP)

Sign In for Pricing
View Details
Lentiviral human NTAQ1 sgRNA gene knockout kit - Lentiviral human NTAQ1 sgRNA gene knockout kit (100)
GTR15368422 1 Vial

Lentiviral human NTAQ1 sgRNA gene knockout kit - Lentiviral human NTAQ1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Kl Peptide - N-terminal region
MBS3228230-01 0.1 mg

Kl Peptide - N-terminal region

Sign In for Pricing
View Details