Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBEF1 Rabbit Polyclonal Antibody (Biotin)

PBEF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

VF, PBEF, PBEF1, VISFATIN, 1110035O14Rik

UniProt

P43490

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005737

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX2/Cyclooxygenase 2/PTGS2 Rabbit Polyclonal Antibody (APC)
orb2615726 100 µg

COX2/Cyclooxygenase 2/PTGS2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rabbit Rho-Associated Protein Kinase 2 (ROCK2) ELISA Kit
MBS2614806-01 48 Well

Rabbit Rho-Associated Protein Kinase 2 (ROCK2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Rho-Associated Protein Kinase 2 (ROCK2) ELISA Kit
MBS2614806-02 96 Well

Rabbit Rho-Associated Protein Kinase 2 (ROCK2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Rho-Associated Protein Kinase 2 (ROCK2) ELISA Kit
MBS2614806-03 5x 96 Well

Rabbit Rho-Associated Protein Kinase 2 (ROCK2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Rho-Associated Protein Kinase 2 (ROCK2) ELISA Kit
MBS2614806-04 10x 96 Well

Rabbit Rho-Associated Protein Kinase 2 (ROCK2) ELISA Kit

Sign In for Pricing
View Details
Claudin 1 (CLDN1) Antibody (Loop1)
MBS9204797-01 0.08 mL

Claudin 1 (CLDN1) Antibody (Loop1)

Sign In for Pricing
View Details