Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBEF1 Rabbit Polyclonal Antibody (FITC)

PBEF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VF, PBEF, PBEF1, VISFATIN, 1110035O14Rik

UniProt

P43490

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005737

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Nibrin Antibody
MBS9239203-01 0.05 mL

Anti-Nibrin Antibody

Sign In for Pricing
View Details
Anti-Nibrin Antibody
MBS9239203-02 0.1 mL

Anti-Nibrin Antibody

Sign In for Pricing
View Details
Anti-Nibrin Antibody
MBS9239203-03 5x 0.1 mL

Anti-Nibrin Antibody

Sign In for Pricing
View Details
GPR17, ID (GPR17, Uracil nucleotide/cysteinyl leukotriene receptor, G-protein coupled receptor 17, P2Y-like receptor, R12) (Biotin)
MBS6303812-01 0.2 mL

GPR17, ID (GPR17, Uracil nucleotide/cysteinyl leukotriene receptor, G-protein coupled receptor 17, P2Y-like receptor, R12) (Biotin)

Sign In for Pricing
View Details
GPR17, ID (GPR17, Uracil nucleotide/cysteinyl leukotriene receptor, G-protein coupled receptor 17, P2Y-like receptor, R12) (Biotin)
MBS6303812-02 5x 0.2 mL

GPR17, ID (GPR17, Uracil nucleotide/cysteinyl leukotriene receptor, G-protein coupled receptor 17, P2Y-like receptor, R12) (Biotin)

Sign In for Pricing
View Details
FUS, CT (FUS, TLS, RNA-binding protein FUS, 75kD DNA-pairing protein, Oncogene FUS, Oncogene TLS, POMp75, Translocated in liposarcoma protein) (MaxLight 750) discontinued
035794-ML750 100 µL

FUS, CT (FUS, TLS, RNA-binding protein FUS, 75kD DNA-pairing protein, Oncogene FUS, Oncogene TLS, POMp75, Translocated in liposarcoma protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details