Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS2 Rabbit Polyclonal Antibody (Biotin)

DHRS2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HEP27, SDR25C1

UniProt

Q53GS4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DHRS2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPOPL Recombinant Protein (Rat)
RP230888 100 µg

SPOPL Recombinant Protein (Rat)

Sign In for Pricing
View Details
GGT6 (Gamma-glutamyltransferase 6, Gamma-glutamyltranspeptidase 6, Glutathione Hydrolase 6, Gamma-glutamyltransferase 6 Heavy Chain, Gamma-glutamyltransferase 6 Light Chain, FLJ25990, FLJ90165)
MBS645724-01 0.05 mg

GGT6 (Gamma-glutamyltransferase 6, Gamma-glutamyltranspeptidase 6, Glutathione Hydrolase 6, Gamma-glutamyltransferase 6 Heavy Chain, Gamma-glutamyltransferase 6 Light Chain, FLJ25990, FLJ90165)

Sign In for Pricing
View Details
GGT6 (Gamma-glutamyltransferase 6, Gamma-glutamyltranspeptidase 6, Glutathione Hydrolase 6, Gamma-glutamyltransferase 6 Heavy Chain, Gamma-glutamyltransferase 6 Light Chain, FLJ25990, FLJ90165)
MBS645724-02 5x 0.05 mg

GGT6 (Gamma-glutamyltransferase 6, Gamma-glutamyltranspeptidase 6, Glutathione Hydrolase 6, Gamma-glutamyltransferase 6 Heavy Chain, Gamma-glutamyltransferase 6 Light Chain, FLJ25990, FLJ90165)

Sign In for Pricing
View Details
Human Keratinocyte Proline Rich Protein (KPRP) ELISA Kit
abx250444 96 Tests

Human Keratinocyte Proline Rich Protein (KPRP) ELISA Kit

Sign In for Pricing
View Details
SHKBP1 (NM_138392) Human Tagged ORF Clone
RG204760 10 µg

SHKBP1 (NM_138392) Human Tagged ORF Clone

Sign In for Pricing
View Details
Kif13a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3965008 1.0 µg DNA

Kif13a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details