Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSLN Rabbit Polyclonal Antibody (HRP)

MSLN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MPF, SMRP

UniProt

Q13421

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MSLN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_005814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rapgef3 (NM_001177810) Mouse Tagged ORF Clone Lentiviral Particle
MR227374L4V 200 µL

Rapgef3 (NM_001177810) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CITCO 25mg
A19467-25 25 mg

CITCO 25mg

Sign In for Pricing
View Details
G protein coupled receptor 30 (GPER1) (NM_001039966) Human Untagged Clone
SC311070 10 µg

G protein coupled receptor 30 (GPER1) (NM_001039966) Human Untagged Clone

Sign In for Pricing
View Details
DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (AP)
MBS6164262-01 0.1 mL

DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (AP)

Sign In for Pricing
View Details
DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (AP)
MBS6164262-02 5x 0.1 mL

DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (AP)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Cytochrome b559 subunit beta (psbF), partial
MBS1076831-01 1 mg (E-Coli)

Recombinant Prochlorococcus marinus Cytochrome b559 subunit beta (psbF), partial

Sign In for Pricing
View Details