Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS16 Rabbit Polyclonal Antibody (FITC)

PRSS16 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TSSP

UniProt

Q9NQE7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TSSP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDGPIFLHLGGEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPA

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ncmap (NM_181047) AAV Particle
MR215214A1V 250 µL

Mouse Ncmap (NM_181047) AAV Particle

Sign In for Pricing
View Details
CTRL Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV655387 1.0 µg DNA

CTRL Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DNA-PK (DNA-Dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, PRKDC, HYRC, HYRC1) discontinued
222191-01 50 µL

DNA-PK (DNA-Dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, PRKDC, HYRC, HYRC1) discontinued

Sign In for Pricing
View Details
DNA-PK (DNA-Dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, PRKDC, HYRC, HYRC1) discontinued
222191-02 100 µL

DNA-PK (DNA-Dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, PRKDC, HYRC, HYRC1) discontinued

Sign In for Pricing
View Details
Recombinant Rat TNFRSF1B protein, N-His Tag
IMP-2445 10 µg

Recombinant Rat TNFRSF1B protein, N-His Tag

Sign In for Pricing
View Details
Pmvk 3'UTR GFP Stable Cell Line
TU266462 1.0 mL

Pmvk 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details