Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYH1 Rabbit Polyclonal Antibody (Biotin)

MYH1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MYHa, HEL71, MYHSA1, MyHC-2x, MyHC-2X/D

UniProt

P12882

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYH1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

223kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005954

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFYVE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C2]
TA810182BM 100 µL

ZFYVE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C2]

Sign In for Pricing
View Details
Recombinant MCAK Antibody
RC-16068-01 50 μL

Recombinant MCAK Antibody

Sign In for Pricing
View Details
Recombinant MCAK Antibody
RC-16068-02 100 µL

Recombinant MCAK Antibody

Sign In for Pricing
View Details
Recombinant MCAK Antibody
RC-16068-03 1 mL

Recombinant MCAK Antibody

Sign In for Pricing
View Details
Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), Biotin conjugate, 0.1mg/mL
BNCB3781-100 1x 100 µL

Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retnlg Mouse Gene Knockout Kit (CRISPR)
KN514680 1 Kit

Retnlg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details