Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYH1 Rabbit Polyclonal Antibody (HRP)

MYH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MYHa, HEL71, MYHSA1, MyHC-2x, MyHC-2X/D

UniProt

P12882

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

223kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005954

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Armc1 Mouse Gene Knockout Kit (CRISPR)
KN501586 1 Kit

Armc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TUSC5 Antibody
8C11319-AAT 50 µg

TUSC5 Antibody

Sign In for Pricing
View Details
DDIT3 Rabbit Polyclonal Antibody
TA375372 100 µL

DDIT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190L-01 50 Tests

Elab Fluor® 488 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190L-02 100 Tests

Elab Fluor® 488 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details