Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lgals4 Rabbit Polyclonal Antibody (HRP)

Lgals4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gal-4, galect

UniProt

Q8K419

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034836

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cytoglobin/ CYGB Protein, His-SUMO, E.coli-1mg
QP5901-ec-1mg 1mg

Recombinant Human Cytoglobin/ CYGB Protein, His-SUMO, E.coli-1mg

Sign In for Pricing
View Details
Iqgap2 AAV siRNA Pooled Vector
25065164 1.0 µg

Iqgap2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
EF-1 γ CRISPR Activation Plasmid (m2)
sc-426418-ACT-2 20 µg

EF-1 γ CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Enterobacter cloacae Trp operon repressor (trpR)
MBS1250402-01 0.02 mg (E-Coli)

Recombinant Enterobacter cloacae Trp operon repressor (trpR)

Sign In for Pricing
View Details
Recombinant Enterobacter cloacae Trp operon repressor (trpR)
MBS1250402-02 0.1 mg (E-Coli)

Recombinant Enterobacter cloacae Trp operon repressor (trpR)

Sign In for Pricing
View Details
Recombinant Enterobacter cloacae Trp operon repressor (trpR)
MBS1250402-03 0.02 mg (Yeast)

Recombinant Enterobacter cloacae Trp operon repressor (trpR)

Sign In for Pricing
View Details