Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NNMT Rabbit Polyclonal Antibody (HRP)

NNMT Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P40261

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NNMT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_006160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSH2D polyclonal antibody
BS77170-01 50 µL

HSH2D polyclonal antibody

Sign In for Pricing
View Details
HSH2D polyclonal antibody
BS77170-02 100 µL

HSH2D polyclonal antibody

Sign In for Pricing
View Details
CGGBP1, CT (CGGBP1, CGGBP, CGG triplet repeat-binding protein 1, 20kD CGG-binding protein, p20-CGGBP DNA-binding protein) (Biotin) discontinued
033820-Biotin 200 µL

CGGBP1, CT (CGGBP1, CGGBP, CGG triplet repeat-binding protein 1, 20kD CGG-binding protein, p20-CGGBP DNA-binding protein) (Biotin) discontinued

Sign In for Pricing
View Details
HIPK3 Rabbit Polyclonal Antibody (PE)
orb496846 100 µL

HIPK3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
PAPD7 siRNA (Mouse)
MBS8235413-01 15 nmol

PAPD7 siRNA (Mouse)

Sign In for Pricing
View Details
PAPD7 siRNA (Mouse)
MBS8235413-02 30 nmol

PAPD7 siRNA (Mouse)

Sign In for Pricing
View Details