Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FST Rabbit Polyclonal Antibody (HRP)

FST Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FS

UniProt

B5BU94

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FST

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006341

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS621545 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human/Mouse CD44 Antibody[IM7]
E-AB-F1100UL-01 25 µg

Elab Fluor® 488 Anti-Human/Mouse CD44 Antibody[IM7]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human/Mouse CD44 Antibody[IM7]
E-AB-F1100UL-02 100 µg

Elab Fluor® 488 Anti-Human/Mouse CD44 Antibody[IM7]

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]
TA500020BM 100 µL

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF640R conjugate, 0.1mg/mL
BNC401654-100 1x 100 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details