Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FST Rabbit Polyclonal Antibody (FITC)

FST Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FS

UniProt

Q6FHE1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FST

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006341

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ER alpha/NR3A1 Antibody [CoraFluor 1]
NB200-347CL1 0.1 mL

Rabbit Polyclonal ER alpha/NR3A1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Cystinosin CRISPR Activation Plasmid (m2)
sc-429900-ACT-2 20 µg

Cystinosin CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Human ELMOD1 Protein Lysate
MBS8411039-01 0.02 mg

Human ELMOD1 Protein Lysate

Sign In for Pricing
View Details
Human ELMOD1 Protein Lysate
MBS8411039-02 5x 0.02 mg

Human ELMOD1 Protein Lysate

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Heat Shock 105kDa/110kDa Protein 1 (HSPH1)
MBS2071692-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Heat Shock 105kDa/110kDa Protein 1 (HSPH1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Heat Shock 105kDa/110kDa Protein 1 (HSPH1)
MBS2071692-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Heat Shock 105kDa/110kDa Protein 1 (HSPH1)

Sign In for Pricing
View Details