Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbln1 Rabbit Polyclonal Antibody (HRP)

Fbln1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D3ZQ25

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Fbln1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FTRPEEIIFLRAVTPLYPANQADIIFDITEGNLRDSFDIIKRYEDGMTVG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001121019

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-A (Leukocyte Antigen A) Sheep ELISA Kit
E0769 96 Tests

HLA-A (Leukocyte Antigen A) Sheep ELISA Kit

Sign In for Pricing
View Details
ErgoOne FAST pipette controller. Includes wall mount holder, two 0.45 micron filters, one 0.2 micron filter, rechargeable battery, and charger.
7166-0010 1 Each

ErgoOne FAST pipette controller. Includes wall mount holder, two 0.45 micron filters, one 0.2 micron filter, rechargeable battery, and charger.

Sign In for Pricing
View Details
RPUSD2 Rabbit pAb
A14397 20 µL

RPUSD2 Rabbit pAb

Sign In for Pricing
View Details
Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-,  10nm
GP-2001-10 1 mL

Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-, 10nm

Sign In for Pricing
View Details
Human Immunodeficiency Virus 2, gp36 (HIV-1, GP36) (MaxLight 650) discontinued
171591-ML650 100 µL

Human Immunodeficiency Virus 2, gp36 (HIV-1, GP36) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Med25 CRISPR/Cas9 KO Plasmid (h)
sc-405325 20 µg

Med25 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details