Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc6a9 Rabbit Polyclonal Antibody (HRP)

Slc6a9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Glyt, Glyt-, Glyt1, Glyt-1

UniProt

P28571

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032161

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Helixyte™ Green Fluorimetric Total Nucleic Acid Quantitation Kit *Optimized for Microplate Readers*
17630-AAT 200 Tests

Helixyte™ Green Fluorimetric Total Nucleic Acid Quantitation Kit *Optimized for Microplate Readers*

Sign In for Pricing
View Details
Acot13 (NM_025790) Mouse Tagged ORF Clone
MG200881 10 µg

Acot13 (NM_025790) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tsc22d3 Mouse Gene Knockout Kit (CRISPR)
KN318324LP 1 Kit

Tsc22d3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CISD3 (NM_001136498) Human Over-expression Lysate
LC427897 20 µg

CISD3 (NM_001136498) Human Over-expression Lysate

Sign In for Pricing
View Details
Casanthranol (A mixture of Casanthranol A, Casanthranol B, Cascaroside A and Cascaroside B) (Technical Grade)
TRC-C226503-500MG 500 mg

Casanthranol (A mixture of Casanthranol A, Casanthranol B, Cascaroside A and Cascaroside B) (Technical Grade)

Sign In for Pricing
View Details
5α-Pregnan-3β, 20α diol 3-sulfate-d5 Sodium Salt
TRC-P627711-10MG 10 mg

5α-Pregnan-3β, 20α diol 3-sulfate-d5 Sodium Salt

Sign In for Pricing
View Details