Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF19 Rabbit Polyclonal Antibody (HRP)

ZNF19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KOX12

UniProt

P17023

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_008892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ITIH3 Protein, N-His
orb2968094-01 50 µg

Recombinant Human ITIH3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ITIH3 Protein, N-His
orb2968094-02 100 µg

Recombinant Human ITIH3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ITIH3 Protein, N-His
orb2968094-03 1 mg

Recombinant Human ITIH3 Protein, N-His

Sign In for Pricing
View Details
Human Testicular Endothelial Cells
ARP0080 0.5 Million

Human Testicular Endothelial Cells

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Breakpoint Cluster Region (BCR)
MBS2064952-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Breakpoint Cluster Region (BCR)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Breakpoint Cluster Region (BCR)
MBS2064952-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Breakpoint Cluster Region (BCR)

Sign In for Pricing
View Details