Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCGN Rabbit Polyclonal Antibody (FITC)

SCGN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SEGN, CALBL, SECRET, setagin, DJ501N12.8

UniProt

O76038

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SCGN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008929

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRINA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV665074 1.0 µg DNA

GRINA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
FOXP1 Knockout HT29 Polyclonal Cells
ARG14693 1 Million

FOXP1 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Herpes Simplex Virus I, Glycoprotein G1 (HSVI, gG-1) (MaxLight 490)
MBS6198808-01 0.1 mL

Herpes Simplex Virus I, Glycoprotein G1 (HSVI, gG-1) (MaxLight 490)

Sign In for Pricing
View Details
Herpes Simplex Virus I, Glycoprotein G1 (HSVI, gG-1) (MaxLight 490)
MBS6198808-02 5x 0.1 mL

Herpes Simplex Virus I, Glycoprotein G1 (HSVI, gG-1) (MaxLight 490)

Sign In for Pricing
View Details
ADAM12 antibody
70R-6059 50 ug

ADAM12 antibody

Sign In for Pricing
View Details
VAMP3, ID (VAMP3, SYB3, Vesicle-associated membrane protein 3, Cellubrevin, Synaptobrevin-3) (Biotin)
043701-Biotin 200 µL

VAMP3, ID (VAMP3, SYB3, Vesicle-associated membrane protein 3, Cellubrevin, Synaptobrevin-3) (Biotin)

Sign In for Pricing
View Details