Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCGN Rabbit Polyclonal Antibody (Biotin)

SCGN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SEGN, CALBL, SECRET, setagin, DJ501N12.8

UniProt

O76038

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SCGN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008929

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIF22 (NM_001256269) AAV Particle
RC234520A1V 250 µL

Human KIF22 (NM_001256269) AAV Particle

Sign In for Pricing
View Details
Kdf1 Rat shRNA Plasmid (Locus ID 313018)
TR700608 1 Kit

Kdf1 Rat shRNA Plasmid (Locus ID 313018)

Sign In for Pricing
View Details
Lentiviral mouse Fbxl18 shRNA (UAS) - Lentiviral mouse Fbxl18 shRNA (UAS, RFP) (100)
GTR15261900 1 Vial

Lentiviral mouse Fbxl18 shRNA (UAS) - Lentiviral mouse Fbxl18 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
EGFLAM (NM_152403) Human Tagged ORF Clone Lentiviral Particle
RC220450L3V 200 µL

EGFLAM (NM_152403) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Vertical Electrophoresis Tank (4 Gels)
50060432 1 Unit

Vertical Electrophoresis Tank (4 Gels)

Sign In for Pricing
View Details
GENLISA™ Human Relaxin (RLN) ELISA
KBH1324 1x 96 Well

GENLISA™ Human Relaxin (RLN) ELISA

Sign In for Pricing
View Details