Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMBT1 Rabbit Polyclonal Antibody (Biotin)

DMBT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SAG, GP340, SALSA, muclin

UniProt

Q9UGM3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DMBT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

258kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_015568

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM220 siRNA (Human)
CRJ7789-01 15 nmol

TMEM220 siRNA (Human)

Sign In for Pricing
View Details
TMEM220 siRNA (Human)
CRJ7789-02 30 nmol

TMEM220 siRNA (Human)

Sign In for Pricing
View Details
5- (3-Methylpiperazin-1-yl) isoquinoline
IJC02923-01 50 mg

5- (3-Methylpiperazin-1-yl) isoquinoline

Sign In for Pricing
View Details
5- (3-Methylpiperazin-1-yl) isoquinoline
IJC02923-02 0.5 g

5- (3-Methylpiperazin-1-yl) isoquinoline

Sign In for Pricing
View Details
MXD3, NT (MXD3, BHLHC13, MAD3, Max dimerization protein 3, Class C basic helix-loop-helix protein 13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx)
MBS644285-01 0.2 mL

MXD3, NT (MXD3, BHLHC13, MAD3, Max dimerization protein 3, Class C basic helix-loop-helix protein 13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx)

Sign In for Pricing
View Details
MXD3, NT (MXD3, BHLHC13, MAD3, Max dimerization protein 3, Class C basic helix-loop-helix protein 13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx)
MBS644285-02 5x 0.2 mL

MXD3, NT (MXD3, BHLHC13, MAD3, Max dimerization protein 3, Class C basic helix-loop-helix protein 13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx)

Sign In for Pricing
View Details