What is the catalog number for GPR161 Rabbit Polyclonal Antibody (HRP)?

The catalog number for GPR161 Rabbit Polyclonal Antibody (HRP) is orb2122331.

What sizes are available for GPR161 Rabbit Polyclonal Antibody (HRP)?

GPR161 Rabbit Polyclonal Antibody (HRP) is available in the following size(s): 100 µL.

Is GPR161 Rabbit Polyclonal Antibody (HRP) in stock?

GPR161 Rabbit Polyclonal Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

GPR161 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RE2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR161

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.