Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PXDN Rabbit Polyclonal Antibody (HRP)

PXDN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PXN, VPO, MG50, PRG2, ASGD7, COPOA, D2S448, D2S448E

UniProt

Q92626

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PXDN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione peroxidase 1 / GPX1 (1-203, His-tag) Human Protein
AR50098PU-N 500 µg

Glutathione peroxidase 1 / GPX1 (1-203, His-tag) Human Protein

Sign In for Pricing
View Details
Human FBXO10 Knockout HEK293T cell line
GTR15403303 1 Vial

Human FBXO10 Knockout HEK293T cell line

Sign In for Pricing
View Details
FBXW22 Double Nickase Plasmid (m2)
sc-436382-NIC-2 20 µg

FBXW22 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
NUF2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61893R-BF488-01 20 µL

NUF2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
NUF2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61893R-BF488-02 100 µL

NUF2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Phospho-FAK (Tyr577) Rabbit Polyclonal Antibody (PerCP)
orb1589601 100 µL

Phospho-FAK (Tyr577) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details