G-CSF, Rhesus Macaque

CSF3 Protein, a member of the IL-6 superfamily, is a vital granulocyte/macrophage colony-stimulating factor influencing hematopoiesis. It regulates the production, differentiation, and function of granulocytes and monocytes-macrophages, playing a key role in the intricate balance of hematopoietic processes. CSF3's significance within the IL-6 superfamily extends to orchestrating immune system components for optimal functionality. G-CSF Protein, Rhesus Macaque is the recombinant rhesus macaque-derived G-CSF, expressed by E. coli , with tag Free labeled tag. The total length of G-CSF Protein, Rhesus Macaque is 177 a.a.,

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS