Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB13 Rabbit Polyclonal Antibody (Biotin)

SERPINB13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HUR7, PI13, headpin, HSHUR7SEQ

UniProt

Q9UIV8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINB13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0182 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
25522111 3x 1.0 µg

KIAA0182 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SGPP2, NT (SGPP2, Sphingosine-1-phosphate phosphatase 2, Sphingosine-1-phosphatase 2) (FITC) discontinued
041674-FITC 200 µL

SGPP2, NT (SGPP2, Sphingosine-1-phosphate phosphatase 2, Sphingosine-1-phosphatase 2) (FITC) discontinued

Sign In for Pricing
View Details
PFKFB3/PFK2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-12631R-BF647 100 µL

PFKFB3/PFK2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Duck Myelin Basic Protein Autoantibody (Anti-MBP) ELISA Kit
MBS9398501 Inquire

Duck Myelin Basic Protein Autoantibody (Anti-MBP) ELISA Kit

Sign In for Pricing
View Details
Zfp161 (NM_172325) Rat Tagged ORF Clone
RR210651 10 µg

Zfp161 (NM_172325) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PBX2 AAV siRNA Pooled Vector
36079161 1.0 µg

PBX2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details