Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB13 Rabbit Polyclonal Antibody (HRP)

SERPINB13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HUR7, PI13, headpin, HSHUR7SEQ

UniProt

Q9UIV8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINB13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-2 / CD340 (HRB2/718), CF488A conjugate, 0.1mg/mL
BNC880718-100 1x 100 µL

HER-2 / CD340 (HRB2/718), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BTBD15 (ZBTB44) Rabbit Polyclonal Antibody
TA369847 100 µL

BTBD15 (ZBTB44) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBCE (NM_001079515) Human Over-expression Lysate
LY421507 100 µg

TBCE (NM_001079515) Human Over-expression Lysate

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Anti-Con A Antibody
AAL-1104-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Anti-Con A Antibody

Sign In for Pricing
View Details
Glucosidase 2 subunit beta (PRKCSH) Rabbit Polyclonal Antibody
TA370898 100 µL

Glucosidase 2 subunit beta (PRKCSH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45RA (158-4D3), CF594 conjugate, 0.1mg/mL
BNC940028-100 1x 100 µL

CD45RA (158-4D3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details