Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grem1 Rabbit Polyclonal Antibody (FITC)

Grem1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Dr, ld, Drm, gre, Grem, Cktsf1b, Cktsf1b1

UniProt

O70326

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Grem1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035954

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uteroglobin (SCGB1A1) Human siRNA Oligo Duplex (Locus ID 7356)
SR305023 1 Kit

Uteroglobin (SCGB1A1) Human siRNA Oligo Duplex (Locus ID 7356)

Sign In for Pricing
View Details
Ccr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
15422114 3x 1.0 µg

Ccr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Zinc finger protein 611, ZNF611 ELISA Kit
MBS9320715-01 48 Well

Human Zinc finger protein 611, ZNF611 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 611, ZNF611 ELISA Kit
MBS9320715-02 96 Well

Human Zinc finger protein 611, ZNF611 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 611, ZNF611 ELISA Kit
MBS9320715-03 5x 96 Well

Human Zinc finger protein 611, ZNF611 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 611, ZNF611 ELISA Kit
MBS9320715-04 10x 96 Well

Human Zinc finger protein 611, ZNF611 ELISA Kit

Sign In for Pricing
View Details