Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grem1 Rabbit Polyclonal Antibody (HRP)

Grem1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dr, ld, Drm, gre, Grem, Cktsf1b, Cktsf1b1

UniProt

O70326

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Grem1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035954

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA9 Rabbit Polyclonal Antibody
E10G01426 100 µL

HSPA9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PEG10 ELISA Kit (Mouse) (OKEH05137)
OKEH05137 96 Well

PEG10 ELISA Kit (Mouse) (OKEH05137)

Sign In for Pricing
View Details
KDM5B Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-6139R-BF488 100 µL

KDM5B Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
SUN1 sgRNA CRISPR Lentivector (Human) (Target 1)
K2808702 1.0 µg DNA

SUN1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-Mouse PREPL (KIAA0436), Rabbit Polyclonal
MKA0436 Inquire

Anti-Mouse PREPL (KIAA0436), Rabbit Polyclonal

Sign In for Pricing
View Details
MAVS Protein Vector (Mouse) (pPM-C-HA)
PV199480 500 ng

MAVS Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details