Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL7A Rabbit Polyclonal Antibody (HRP)

METTL7A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AAMB, AAM-B

UniProt

Q9H8H3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human METTL7A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAF20268

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transaldolase 1 (TALDO1) Mouse Monoclonal Antibody [Clone ID: OTI2E4]
CF809857 100 µg

Transaldolase 1 (TALDO1) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

Sign In for Pricing
View Details
Mouse Cys-C Antibody Pair Set
E-KAB-0073 50 µL & 100 µg

Mouse Cys-C Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS648734 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
ARP10 (APOBEC3H) (NM_001166004) Human Over-expression Lysate
LC431117 20 µg

ARP10 (APOBEC3H) (NM_001166004) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Macrophage Inflammatory Protein 4 Alpha (MIP4a) ELISA Kit
RDR-MIP4a-Hu-01 96 Tests

Human Macrophage Inflammatory Protein 4 Alpha (MIP4a) ELISA Kit

Sign In for Pricing
View Details
Human Macrophage Inflammatory Protein 4 Alpha (MIP4a) ELISA Kit
RDR-MIP4a-Hu-02 48 Tests

Human Macrophage Inflammatory Protein 4 Alpha (MIP4a) ELISA Kit

Sign In for Pricing
View Details