Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Il17b Rabbit Polyclonal Antibody (FITC)

Il17b Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

G3V8K9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Il17b

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARM

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_446241

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX2 Rabbit pAb, Pacific Blue conjugated
orb2875833 100 µL

DLX2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
GALNT13 (KIAA1918, Polypeptide N-acetylgalactosaminyltransferase 13, Polypeptide GalNAc Transferase 13, Protein-UDP Acetylgalactosaminyltransferase 13, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13, FLJ16031, FLJ41157, H_NH0187G20.1, MGC119459, MGC119461)
127132 50 µg

GALNT13 (KIAA1918, Polypeptide N-acetylgalactosaminyltransferase 13, Polypeptide GalNAc Transferase 13, Protein-UDP Acetylgalactosaminyltransferase 13, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13, FLJ16031, FLJ41157, H_NH0187G20.1, MGC119459, MGC119461)

Sign In for Pricing
View Details
14-3-3, sigma (SFN, Stratifin, HGNC:10773) (BSA & Azide Free) (PE)
0014-07A-PE 100 µL

14-3-3, sigma (SFN, Stratifin, HGNC:10773) (BSA & Azide Free) (PE)

Sign In for Pricing
View Details
GNE-0439 10mg
A19138-10 10 mg

GNE-0439 10mg

Sign In for Pricing
View Details
Olr629 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7383806 1.0 µg DNA

Olr629 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
BUB1 shRNA Plasmid (h)
sc-37538-SH 20 µg

BUB1 shRNA Plasmid (h)

Sign In for Pricing
View Details