Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plekha6 Rabbit Polyclonal Antibody (HRP)

Plekha6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1564395

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Plekha6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SATYSSNSPASPLSSASLTSPLSPFSMVSGSQGSPTKPGSSEPKTDYEPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

120kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_001060716

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPG48 Rabbit pAb, Pacific Blue conjugated
orb2883530 100 µL

SPG48 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
GATA5 Rabbit Polyclonal Antibody (Fluoro488)
orb3078489 100 µg

GATA5 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
MS4A5 Antibody
59-771 400 µL

MS4A5 Antibody

Sign In for Pricing
View Details
CACNA1C Rabbit Polyclonal Antibody
E53P09634 100 µL

CACNA1C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-KIF20A (S528) Polyclonal Antibody
MBS2537782-01 0.02 mL

Phospho-KIF20A (S528) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-KIF20A (S528) Polyclonal Antibody
MBS2537782-02 0.06 mL

Phospho-KIF20A (S528) Polyclonal Antibody

Sign In for Pricing
View Details