Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYO16 Rabbit Polyclonal Antibody (Biotin)

MYO16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MYR8, MYAP3, NYAP3, Myo16b, PPP1R107

UniProt

Q9Y6X6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MYO16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPHLFSCVERAFHQLFREQRPQCFILSGERGSGKSEASKQIIRHLTCRAG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8- Bromo- 2'- O- methyladenosine- 3', 5'- cyclic monophosphate, acetoxymethyl ester (8-Br-2'-O-Me-cAMP-AM)
B 028-05 5x 1 µmol

8- Bromo- 2'- O- methyladenosine- 3', 5'- cyclic monophosphate, acetoxymethyl ester (8-Br-2'-O-Me-cAMP-AM)

Sign In for Pricing
View Details
GSAP Antibody - N-terminal region : Biotin (ARP48798_P050-Biotin)
ARP48798_P050-Biotin 100 µL

GSAP Antibody - N-terminal region : Biotin (ARP48798_P050-Biotin)

Sign In for Pricing
View Details
Interleukin 10 (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF) (MaxLight 550) discontinued
I8432-20A-ML550 100 µL

Interleukin 10 (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal CCL2/JE/MCP-1 Antibody (001) [DyLight 594]
NBP2-90550DL594 0.1 mL

Rabbit Monoclonal CCL2/JE/MCP-1 Antibody (001) [DyLight 594]

Sign In for Pricing
View Details
Goat Hermansky Pudlak syndrome 1 protein (HPS1) ELISA Kit
GTR10313809 96 Well

Goat Hermansky Pudlak syndrome 1 protein (HPS1) ELISA Kit

Sign In for Pricing
View Details
RAB28 siRNA (Rat)
CRR3045-01 15 nmol

RAB28 siRNA (Rat)

Sign In for Pricing
View Details