Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYO16 Rabbit Polyclonal Antibody (Biotin)

MYO16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MYR8, MYAP3, NYAP3, Myo16b, PPP1R107

UniProt

Q9Y6X6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MYO16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPHLFSCVERAFHQLFREQRPQCFILSGERGSGKSEASKQIIRHLTCRAG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Slc17a1 Pre-designed siRNA Set B
SI113028B 1 Each

Mouse Slc17a1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
DGKG (Diacylglycerol Kinase gamma, DAG Kinase gamma, Diglyceride Kinase gamma, DGK-gamma, DAGK3) (MaxLight 550)
125800-ML550 100 µL

DGKG (Diacylglycerol Kinase gamma, DAG Kinase gamma, Diglyceride Kinase gamma, DGK-gamma, DAGK3) (MaxLight 550)

Sign In for Pricing
View Details
Qars Rat shRNA Plasmid (Locus ID 290868)
TR700814 1 Kit

Qars Rat shRNA Plasmid (Locus ID 290868)

Sign In for Pricing
View Details
ZNF580, ID (ZNF580, Zinc finger protein 580, LDL-induced EC protein) (FITC)
MBS6367122-01 0.2 mL

ZNF580, ID (ZNF580, Zinc finger protein 580, LDL-induced EC protein) (FITC)

Sign In for Pricing
View Details
ZNF580, ID (ZNF580, Zinc finger protein 580, LDL-induced EC protein) (FITC)
MBS6367122-02 5x 0.2 mL

ZNF580, ID (ZNF580, Zinc finger protein 580, LDL-induced EC protein) (FITC)

Sign In for Pricing
View Details
ZFP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV706598 1.0 µg DNA

ZFP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details