Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYO16 Rabbit Polyclonal Antibody (HRP)

MYO16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MYR8, MYAP3, NYAP3, Myo16b, PPP1R107

UniProt

Q9Y6X6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MYO16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPHLFSCVERAFHQLFREQRPQCFILSGERGSGKSEASKQIIRHLTCRAG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ChAT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV702449 1.0 µg DNA

ChAT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CCDC101 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
15163061 1.0 µg DNA

CCDC101 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ELP3 Protein Vector (Human) (pPM-C-HA)
19241021 500 ng

ELP3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila slyD Protein
VAng-Lsx0661-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Hydrophila slyD Protein

Sign In for Pricing
View Details
Hsf1 Rabbit mAb
E2R24622 100 µL

Hsf1 Rabbit mAb

Sign In for Pricing
View Details
ASCC1 Protein Vector (Mouse) (pPM-C-HA)
12521024 500 ng

ASCC1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details