Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYO16 Rabbit Polyclonal Antibody (HRP)

MYO16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MYR8, MYAP3, NYAP3, Myo16b, PPP1R107

UniProt

Q9Y6X6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MYO16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPHLFSCVERAFHQLFREQRPQCFILSGERGSGKSEASKQIIRHLTCRAG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Microtus longicaudus Cytochrome b (MT-CYB), partial
MBS1110652-01 1 mg (E-Coli)

Recombinant Microtus longicaudus Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
Recombinant Microtus longicaudus Cytochrome b (MT-CYB), partial
MBS1110652-02 1 mg (Yeast)

Recombinant Microtus longicaudus Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
GPR143 Antibody
E11-297G 100 µg

GPR143 Antibody

Sign In for Pricing
View Details
PAX8 Polyclonal Antibody, Cy5 Conjugated
bs-1201R-Cy5 100 µL

PAX8 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
RPA2P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV747237 1.0 µg DNA

RPA2P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA 2a, HNA2a, HNA-2a, NB1, NB1 Glycoprotein, NB1 gP, Polycythemia Rubra Vera 1, PRV 1, PRV1, PRV-1) (MaxLight 750) discontinued
C2548-90YB-ML750 100 µL

CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA 2a, HNA2a, HNA-2a, NB1, NB1 Glycoprotein, NB1 gP, Polycythemia Rubra Vera 1, PRV 1, PRV1, PRV-1) (MaxLight 750) discontinued

Sign In for Pricing
View Details