Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLPP2 Rabbit Polyclonal Antibody (Biotin)

PHLPP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PPM3B, PHLPPL

UniProt

Q6ZVD8

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence ASSFSLTVANVGTCQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAII

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASSFSLTVANVGTCQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAII

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

147 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_055835

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTAGE6P (cTAGE Family Member 6, Protein cTAGE-6, CTAGE6, CTAGE6P) (MaxLight 750)
MBS6455313-01 0.1 mL

CTAGE6P (cTAGE Family Member 6, Protein cTAGE-6, CTAGE6, CTAGE6P) (MaxLight 750)

Sign In for Pricing
View Details
CTAGE6P (cTAGE Family Member 6, Protein cTAGE-6, CTAGE6, CTAGE6P) (MaxLight 750)
MBS6455313-02 5x 0.1 mL

CTAGE6P (cTAGE Family Member 6, Protein cTAGE-6, CTAGE6, CTAGE6P) (MaxLight 750)

Sign In for Pricing
View Details
ISX/Intestine specific homeobox Rabbit Polyclonal Antibody (BF488)
orb2482918 100 µL

ISX/Intestine specific homeobox Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Human Urine-Derived Stem Cells Adipogenic Differentiation Medium Kit
RC0032 200 mL

Human Urine-Derived Stem Cells Adipogenic Differentiation Medium Kit

Sign In for Pricing
View Details
Mouse Ttc29 qPCR Primer Pair
QM41934S 200 Tests

Mouse Ttc29 qPCR Primer Pair

Sign In for Pricing
View Details
PKP1 Protein Vector (Human) (pPM-C-His)
PV056336 500 ng

PKP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details