Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NELF Rabbit Polyclonal Antibody (HRP)

NELF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HH9, NELF

UniProt

Q6X4W1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NELF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAW88391

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (CD7 Antigen, GP40, LEU 9, LEU-9, p41, T cell Antigen CD7 Precursor, T cell Leukemia Antigen, Tp40, TP41) (PE) discontinued
C2258-02C-PE 100 µL

CD7 (CD7 Antigen, GP40, LEU 9, LEU-9, p41, T cell Antigen CD7 Precursor, T cell Leukemia Antigen, Tp40, TP41) (PE) discontinued

Sign In for Pricing
View Details
Human GAL1 (Galectin 1) ELISA Kit
E-EL-H1051-01 24 Tests

Human GAL1 (Galectin 1) ELISA Kit

Sign In for Pricing
View Details
Human GAL1 (Galectin 1) ELISA Kit
E-EL-H1051-02 48 Tests

Human GAL1 (Galectin 1) ELISA Kit

Sign In for Pricing
View Details
Human GAL1 (Galectin 1) ELISA Kit
E-EL-H1051-03 96 Tests

Human GAL1 (Galectin 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Mouse Glutathione S Transferase Alpha 1 (GSTa1) Polyclonal Antibody
VD2N39 1 Each

Rabbit Anti-Mouse Glutathione S Transferase Alpha 1 (GSTa1) Polyclonal Antibody

Sign In for Pricing
View Details
IRF4 Rabbit Polyclonal Antibody
orb514422 100 µg

IRF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details