Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD5 Rabbit Polyclonal Antibody (HRP)

ABHD5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI58, IECN2, NCIE2

UniProt

Q8WTS1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABHD5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_057090

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8- (6-Aminohexyl) -amino-GTP-ATTO-532
NU-830-532 120 µL

8- (6-Aminohexyl) -amino-GTP-ATTO-532

Sign In for Pricing
View Details
Guinea pig Mediator of RNA polymerase II transcription subunit 8 (MED8) ELISA Kit
MBS7207194-01 48 Well

Guinea pig Mediator of RNA polymerase II transcription subunit 8 (MED8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Mediator of RNA polymerase II transcription subunit 8 (MED8) ELISA Kit
MBS7207194-02 96 Well

Guinea pig Mediator of RNA polymerase II transcription subunit 8 (MED8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Mediator of RNA polymerase II transcription subunit 8 (MED8) ELISA Kit
MBS7207194-03 5x 96 Well

Guinea pig Mediator of RNA polymerase II transcription subunit 8 (MED8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Mediator of RNA polymerase II transcription subunit 8 (MED8) ELISA Kit
MBS7207194-04 10x 96 Well

Guinea pig Mediator of RNA polymerase II transcription subunit 8 (MED8) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Gastrin/cholecystokinin type B receptor (Cckbr)
MBS7010966-01 0.02 mg

Recombinant Mouse Gastrin/cholecystokinin type B receptor (Cckbr)

Sign In for Pricing
View Details