Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPPP3 Rabbit Polyclonal Antibody (HRP)

TPPP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P20, CGI-38, TPPP/p20, p25gamma

UniProt

Q5PPN5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TPPP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_057224

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin β4 (Phospho-Tyr1510) Polyclonal Antibody
orb309031-01 50 μL

Integrin β4 (Phospho-Tyr1510) Polyclonal Antibody

Sign In for Pricing
View Details
Integrin β4 (Phospho-Tyr1510) Polyclonal Antibody
orb309031-02 100 µL

Integrin β4 (Phospho-Tyr1510) Polyclonal Antibody

Sign In for Pricing
View Details
CD35 Recombinant Antibody
bsm-60247R-TR 20 µL

CD35 Recombinant Antibody

Sign In for Pricing
View Details
CLK3 sgRNA CRISPR Lentivector (Human) (Target 3)
K0466104 1.0 µg DNA

CLK3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal CUL4B Antibody
NBP2-97399-50ul 50 µL

Rabbit Polyclonal CUL4B Antibody

Sign In for Pricing
View Details
Myd88 (NM_010851) Mouse Untagged Clone
MC204847 10 µg

Myd88 (NM_010851) Mouse Untagged Clone

Sign In for Pricing
View Details