Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRNN Rabbit Polyclonal Antibody (HRP)

CRNN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DRC1, PDRC1, SEP53, C1orf10

UniProt

Q9UBG3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CRNN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_057274

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR7843 Human qPCR Primer Pair (MI0025510)
HP301536 200 Reactions

MIR7843 Human qPCR Primer Pair (MI0025510)

Sign In for Pricing
View Details
NODAL Protein Vector (Rat) (pPM-C-HA)
PV285584 500 ng

NODAL Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Guinea Pig cluster of differentiation 45 (CD45) ELISA kit
GTR10464338 96 Well

Guinea Pig cluster of differentiation 45 (CD45) ELISA kit

Sign In for Pricing
View Details
3-Isopropoxy-N-[4- (phenethyloxy) benzyl]aniline
sc-313179 500 mg

3-Isopropoxy-N-[4- (phenethyloxy) benzyl]aniline

Sign In for Pricing
View Details
HRH4 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-10993R-BF680-01 20 µL

HRH4 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
HRH4 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-10993R-BF680-02 100 µL

HRH4 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details