Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPB1 Rabbit Polyclonal Antibody (FITC)

UPB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BUP1

UniProt

Q9UBR1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UPB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057411

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC30A9 (Solute Carrier Family 30 (Zinc Transporter), Member 9)
492035 100 µL

SLC30A9 (Solute Carrier Family 30 (Zinc Transporter), Member 9)

Sign In for Pricing
View Details
Zxdb 3'UTR GFP Stable Cell Line
TU173055 1.0 mL

Zxdb 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MRPS18AP1 AAV Vector (Human) (CMV)
30542101 1 µg

MRPS18AP1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
CNGB3 Adenovirus (Human)
16456051 1.0 mL

CNGB3 Adenovirus (Human)

Sign In for Pricing
View Details
NG2 Rabbit Polyclonal Antibody (Cy3)
orb989609 100 µL

NG2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
HNF4A (Hepatocyte Nuclear Factor 4, alpha, FLJ39654, HNF4, HNF4a7, HNF4a8, HNF4a9, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14) (PE)
247163-PE 100 µL

HNF4A (Hepatocyte Nuclear Factor 4, alpha, FLJ39654, HNF4, HNF4a7, HNF4a8, HNF4a9, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14) (PE)

Sign In for Pricing
View Details