Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIPOX Rabbit Polyclonal Antibody (Biotin)

PIPOX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LPIPOX

UniProt

Q9P0Z9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PIPOX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057602

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMP2 Rabbit Polyclonal Antibody (Biotin)
orb446654 100 µL

EMP2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MEF-2 (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2A, MEF2) discontinued
224094-01 50 µL

MEF-2 (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2A, MEF2) discontinued

Sign In for Pricing
View Details
MEF-2 (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2A, MEF2) discontinued
224094-02 100 µL

MEF-2 (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2A, MEF2) discontinued

Sign In for Pricing
View Details
Protein Kinase B Alpha (PKBa) Magnetic Fluorescence Assay Kit
MBS2158453-01 96 Tests

Protein Kinase B Alpha (PKBa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Protein Kinase B Alpha (PKBa) Magnetic Fluorescence Assay Kit
MBS2158453-02 5x 96 Tests

Protein Kinase B Alpha (PKBa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Protein Kinase B Alpha (PKBa) Magnetic Fluorescence Assay Kit
MBS2158453-03 10x 96 Tests

Protein Kinase B Alpha (PKBa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details