Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP2K Rabbit Polyclonal Antibody (HRP)

BMP2K Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BIKE, HRIHFB2017

UniProt

Q4W5H2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BMP2K

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PPM1M Protein - (Dry Ice)
H00132160-P01-25ug 25 µg

Recombinant Human PPM1M Protein - (Dry Ice)

Sign In for Pricing
View Details
BAP1 (3p21) gene deletion probe reagent
FP-058 1 Vial 100 μL (10-20 T)

BAP1 (3p21) gene deletion probe reagent

Sign In for Pricing
View Details
Matrix Metalloproteinase 2 (MMP2) Polyclonal Antibody
CAU28613-01 100 µL

Matrix Metalloproteinase 2 (MMP2) Polyclonal Antibody

Sign In for Pricing
View Details
Matrix Metalloproteinase 2 (MMP2) Polyclonal Antibody
CAU28613-02 200 µL

Matrix Metalloproteinase 2 (MMP2) Polyclonal Antibody

Sign In for Pricing
View Details
Matrix Metalloproteinase 2 (MMP2) Polyclonal Antibody
CAU28613-03 1 mL

Matrix Metalloproteinase 2 (MMP2) Polyclonal Antibody

Sign In for Pricing
View Details
Transcription Factor YY1 (CF1, Delta Transcription Factor, NF E1, NF-E1, Transcriptional Repressor Protein YY1, UCR Motif DNA Binding Protein, UCRBP, Yin and Yang 1, Yin Yang 1, Yin-Yang 1, YY 1, YY1, YY-1, YY1 Transcription Factor) (FITC) discontinued
T8195-90D-FITC 100 µL

Transcription Factor YY1 (CF1, Delta Transcription Factor, NF E1, NF-E1, Transcriptional Repressor Protein YY1, UCR Motif DNA Binding Protein, UCRBP, Yin and Yang 1, Yin Yang 1, Yin-Yang 1, YY 1, YY1, YY-1, YY1 Transcription Factor) (FITC) discontinued

Sign In for Pricing
View Details