Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FERMT1 Rabbit Polyclonal Antibody (HRP)

FERMT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URP1, KIND1, DTGCU2, UNC112A, C20orf42

UniProt

Q9BQL6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FERMT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9130023H24Rik Mouse shRNA Lentiviral Particle (Locus ID 100043133)
TL519769V 500 µL Each

9130023H24Rik Mouse shRNA Lentiviral Particle (Locus ID 100043133)

Sign In for Pricing
View Details
Mouse Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit
MBS9944220-01 48 Well

Mouse Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit
MBS9944220-02 96 Well

Mouse Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit
MBS9944220-03 5x 96 Well

Mouse Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit
MBS9944220-04 10x 96 Well

Mouse Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit

Sign In for Pricing
View Details
IgG, H&L (Texas Red)
I1903-37H 1 mg

IgG, H&L (Texas Red)

Sign In for Pricing
View Details