Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esrp2 Rabbit Polyclonal Antibody (FITC)

Esrp2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rbm35, Rbm35b, 9530027K23Rik

UniProt

Q8K0G8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_789808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Car5b Protein Vector (Mouse) (pPM-C-HA)
15026024 500 ng

Car5b Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PQBP1 (NM_001032383) Human Recombinant Protein
TP324043M 100 µg

PQBP1 (NM_001032383) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human PTPRO shRNA (UAS) - Lentiviral human PTPRO shRNA (UAS, RFP) (100)
GTR15337383 1 Vial

Lentiviral human PTPRO shRNA (UAS) - Lentiviral human PTPRO shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
SPG7 Mouse Monoclonal Antibody [Clone ID: LBI1D3]
AMM12418V 100 µL

SPG7 Mouse Monoclonal Antibody [Clone ID: LBI1D3]

Sign In for Pricing
View Details
Mouse Monoclonal CD74 Antibody (rCLIP/8679) [FITC]
NBP3-24339F 0.1 mL

Mouse Monoclonal CD74 Antibody (rCLIP/8679) [FITC]

Sign In for Pricing
View Details
Survivin (API4, IAP4, Apoptosis inhibitor 4, Apoptosis inhibitor survivin, EPR-1, survivin, survivin variant 3 alpha, baculoviral IAP repeat-containing 5, ) (APC) discontinued
145241-APC 100 µL

Survivin (API4, IAP4, Apoptosis inhibitor 4, Apoptosis inhibitor survivin, EPR-1, survivin, survivin variant 3 alpha, baculoviral IAP repeat-containing 5, ) (APC) discontinued

Sign In for Pricing
View Details