EPS8L1 Rabbit Polyclonal Antibody (HRP)
EPS8L1 Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
DRC3, EPS8R1, PP10566
UniProt
Q8TE68
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EPS8L1
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG
Purification
Affinity Purified
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
66kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
Tested Applications
WB
NCBI Accession Number
NP_060199
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4281908 1.0 µg DNA
Olfr1193 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 
222240-01 50 µL
DREAM (AI413860, Calsenilin, CSEN, CSEN, DRE antagonist Modulator, DRE-antagonist Modulator, DREAM, EF hand Transcription Factor, KCHIP 3, KCHIP3, KCNIP 3, KCNIP3, Kv Channel interacting Protein 3, Kv Channel-interacting Protein 3, MGC18289, Potassium Channel interacting Protein 3, Presenilin Binding Protein, R74849) discontinued
Sign In for Pricing
View Details 222240-02 100 µL
DREAM (AI413860, Calsenilin, CSEN, CSEN, DRE antagonist Modulator, DRE-antagonist Modulator, DREAM, EF hand Transcription Factor, KCHIP 3, KCHIP3, KCNIP 3, KCNIP3, Kv Channel interacting Protein 3, Kv Channel-interacting Protein 3, MGC18289, Potassium Channel interacting Protein 3, Presenilin Binding Protein, R74849) discontinued
Sign In for Pricing
View Details 
CAU24479-01 100 µL
Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2) Polyclonal Antibody
Sign In for Pricing
View Details