Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D22A Rabbit Polyclonal Antibody (FITC)

TBC1D22A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C22orf4, HSC79E021

UniProt

Q8WUA7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D22A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mcm8 shRNA (UAS) - Lentiviral mouse Mcm8 shRNA (UAS, RFP) (25)
GTR15178475 1 Vial

Lentiviral mouse Mcm8 shRNA (UAS) - Lentiviral mouse Mcm8 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Escherichia coli trxC Protein (aa 1-139)
VAng-Lsx02674-500gEcoli 500 µg (E. coli)

Recombinant Escherichia coli trxC Protein (aa 1-139)

Sign In for Pricing
View Details
RNF214 (NM_207343) Human Over-expression Lysate
LC403969 20 µg

RNF214 (NM_207343) Human Over-expression Lysate

Sign In for Pricing
View Details
Myosin VA (MYO5A) Antibody
abx014620-01 10 µg

Myosin VA (MYO5A) Antibody

Sign In for Pricing
View Details
Myosin VA (MYO5A) Antibody
abx014620-02 100 µg

Myosin VA (MYO5A) Antibody

Sign In for Pricing
View Details
Myosin VA (MYO5A) Antibody
abx014620-03 200 µg

Myosin VA (MYO5A) Antibody

Sign In for Pricing
View Details