Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D22A Rabbit Polyclonal Antibody (FITC)

TBC1D22A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C22orf4, HSC79E021

UniProt

Q8WUA7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D22A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FAM111B Antibody [DyLight 755]
NBP3-18411IR 0.1 mL

Rabbit Polyclonal FAM111B Antibody [DyLight 755]

Sign In for Pricing
View Details
C17orf97 Protein Vector (Human) (pPM-N-D-C-His)
PV329449 500 ng

C17orf97 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
TMEFF2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62267R-BF750-TR 20 µL

TMEFF2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
TRIB3 Peptide - N-terminal region
orb2002456 100 µg

TRIB3 Peptide - N-terminal region

Sign In for Pricing
View Details
Human Zinc Finger Transcription Factor TRPS1 (TRPS1) ELISA Kit
abx383966-01 96 Tests

Human Zinc Finger Transcription Factor TRPS1 (TRPS1) ELISA Kit

Sign In for Pricing
View Details
Human Zinc Finger Transcription Factor TRPS1 (TRPS1) ELISA Kit
abx383966-02 5x 96 Tests

Human Zinc Finger Transcription Factor TRPS1 (TRPS1) ELISA Kit

Sign In for Pricing
View Details