Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUEDC1 Rabbit Polyclonal Antibody (Biotin)

CUEDC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9NWM3

Immunogen

The immunogen is a synthetic peptide directed towards the N region of human CUED1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEP

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_060419

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Galp qPCR Primer Pair
QM60230S 200 Tests

Mouse Galp qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant European white birch PPIase/Bet v 7 Protein, N-His
orb2961945-01 50 µg

Recombinant European white birch PPIase/Bet v 7 Protein, N-His

Sign In for Pricing
View Details
Recombinant European white birch PPIase/Bet v 7 Protein, N-His
orb2961945-02 100 µg

Recombinant European white birch PPIase/Bet v 7 Protein, N-His

Sign In for Pricing
View Details
Recombinant European white birch PPIase/Bet v 7 Protein, N-His
orb2961945-03 1 mg

Recombinant European white birch PPIase/Bet v 7 Protein, N-His

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (citX)
MBS1084922-01 0.02 mg (E-Coli)

Recombinant Citrobacter koseri Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (citX)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (citX)
MBS1084922-02 0.1 mg (E-Coli)

Recombinant Citrobacter koseri Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (citX)

Sign In for Pricing
View Details