Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSDC1 Rabbit Polyclonal Antibody (FITC)

BSDC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP4-811H24.7, DKFZp686B09139, FLJ10276

UniProt

Q9NW68

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BSDC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060515

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Polyodon spathula Cytochrome c oxidase subunit 1 (mt-co1)
MBS7021471-01 0.02 mg

Recombinant Polyodon spathula Cytochrome c oxidase subunit 1 (mt-co1)

Sign In for Pricing
View Details
Recombinant Polyodon spathula Cytochrome c oxidase subunit 1 (mt-co1)
MBS7021471-02 0.1 mg

Recombinant Polyodon spathula Cytochrome c oxidase subunit 1 (mt-co1)

Sign In for Pricing
View Details
Recombinant Polyodon spathula Cytochrome c oxidase subunit 1 (mt-co1)
MBS7021471-03 5x 0.1 mg

Recombinant Polyodon spathula Cytochrome c oxidase subunit 1 (mt-co1)

Sign In for Pricing
View Details
BEND3, CT (BEND3, KIAA1553, BEN domain-containing protein 3) (MaxLight 550) discontinued
032493-ML550 100 µL

BEND3, CT (BEND3, KIAA1553, BEN domain-containing protein 3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
YAP1 Conjugated Antibody
MBS9456322-01 0.1 mL (Biotin)

YAP1 Conjugated Antibody

Sign In for Pricing
View Details
YAP1 Conjugated Antibody
MBS9456322-02 0.1 mL (AF350)

YAP1 Conjugated Antibody

Sign In for Pricing
View Details